PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004937.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family FAR1
Protein Properties Length: 211aa    MW: 22422.8 Da    PI: 10.3905
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004937.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR129.52.4e-09148188142
                     FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkre 42 
                              +fY +YA++ GF+vr s+ k+  rngei++r +vCs++g r 
  Itr_sc004937.1_g00002.1 148 QFYMSYARSGGFDVRHSTVKRG-RNGEIVMRYLVCSRQGLRG 188
                              6****************99887.8999************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.3E-6148187IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MATGRGGAGR GILVPVPATP TPSPSPPPSP AGKGKNSPSP SPHASVVFCA TPGRSWITVV  60
SAFVSFADVR FLRYSTCGSF YYAALLVSFT GGQSVLGKAY GVLAMVVVTW WYGVVHRCTG  120
ILDTWPSVDE SLLPFVGCWF QTLTAGIQFY MSYARSGGFD VRHSTVKRGR NGEIVMRYLV  180
CSRQGLRGGG RSKPTPVLGD KGGQTHSPFV L
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06250.12e-08FAR1-related sequence 7